Protein Info for GFF2763 in Xanthobacter sp. DMC5

Annotation: 2,3-dimethylmalate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 PF13714: PEP_mutase" amino acids 8 to 249 (242 residues), 155.4 bits, see alignment E=2e-49 PF00463: ICL" amino acids 77 to 175 (99 residues), 57.8 bits, see alignment E=8e-20

Best Hits

Swiss-Prot: 47% identical to DML_EUBBA: 2,3-dimethylmalate lyase (Dml) from Eubacterium barkeri

KEGG orthology group: K01003, carboxyvinyl-carboxyphosphonate phosphorylmutase [EC: 2.7.8.23] (inferred from 76% identity to mno:Mnod_7954)

MetaCyc: 47% identical to 2,3-dimethylmalate lyase subunit (Eubacterium barkeri)
2,3-dimethylmalate lyase. [EC: 4.1.3.32]

Predicted SEED Role

"Methylisocitrate lyase (EC 4.1.3.30)" in subsystem Methylcitrate cycle or Propionate-CoA to Succinate Module (EC 4.1.3.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.23

Use Curated BLAST to search for 2.7.8.23 or 4.1.3.30 or 4.1.3.32

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (289 amino acids)

>GFF2763 2,3-dimethylmalate lyase (Xanthobacter sp. DMC5)
MRSALVLKNLVARRAAITVPGTANAMFARVIENLGFDAIYVSGAGIANMALGAPDIGLTT
LTEVAEATAAIADAVSLPIIVDADTGFGNAVNMVRTIRMLERAGAAGIQIEDQVFPKKCG
HFSGKEVITTAEMVQKIKAAVDARIDGDIQIIARTDAAAVEGFDGAMERAHAFVEAGADM
TFVEAPVTVEELARIPRELPVPQIANIVFGGRTPDPGREQLTQMGFSLVLYANAALQAAL
KASYEVLEALKRDGSLASVSHRLATFDERQKAVAKDHWDQLETRYSAVP