Protein Info for GFF2762 in Sphingobium sp. HT1-2

Annotation: 4-hydroxybenzoate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 transmembrane" amino acids 36 to 60 (25 residues), see Phobius details amino acids 74 to 93 (20 residues), see Phobius details amino acids 104 to 123 (20 residues), see Phobius details amino acids 129 to 149 (21 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details amino acids 188 to 188 (1 residues), see Phobius details amino acids 190 to 212 (23 residues), see Phobius details amino acids 272 to 292 (21 residues), see Phobius details amino acids 307 to 328 (22 residues), see Phobius details amino acids 337 to 359 (23 residues), see Phobius details amino acids 365 to 384 (20 residues), see Phobius details amino acids 396 to 420 (25 residues), see Phobius details amino acids 426 to 446 (21 residues), see Phobius details PF07690: MFS_1" amino acids 43 to 351 (309 residues), 128.2 bits, see alignment E=5.4e-41 amino acids 274 to 446 (173 residues), 56.8 bits, see alignment E=2.9e-19 PF06779: MFS_4" amino acids 58 to 215 (158 residues), 28.9 bits, see alignment E=1.2e-10 PF00083: Sugar_tr" amino acids 73 to 440 (368 residues), 84 bits, see alignment E=1.6e-27

Best Hits

KEGG orthology group: None (inferred from 44% identity to vap:Vapar_5692)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (451 amino acids)

>GFF2762 4-hydroxybenzoate transporter (Sphingobium sp. HT1-2)
MASYSATGSVSVRPYVTVDGQAAPVASDSLWTARQILVVAICFILNMLDGMDVLILSYIA
PALSTDWQVTPERLGVVFSAGLAGMAAGGLLIAPMADRFGRRTLILASLVMMAGAMFGSA
MAANIGELIVSRFIVGIGIGTVLASMAALTAEYAPPRHRTFAVGFLQAGYPVGATITGFV
VANLLPIYGWQAMLLGAAILCTLSLPFVWLLLPESIDFLLTRQPKGALEKANRLLRSMGQ
PAVDRLPARKVHEANKAGVRGLLTDGRATGTILLWMATISGFMTLYFVISWIPKLAVEAG
LPAKDAIYAGAIYNIGAFVGVTLIGIAGTHFDLRRLILGYMSAAAVTLVLFGSVAMPLIA
TLATAFLIGVFVQGGFNGCYPLAASLYPPEARGTGIGWAMGVGRIGAVIGPMLGGFLLAA
KVSLPVIFGVFAVPAVIAGICAAMIRLPKAD