Protein Info for PS417_14065 in Pseudomonas simiae WCS417

Annotation: UTP--glucose-1-phosphate uridylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01099: UTP--glucose-1-phosphate uridylyltransferase
  • amino acids 2 to 264 (263 residues), 395.4 bits, E=6.2e-123
• PF00483: NTP_transferase
  • amino acids 9 to 268 (260 residues), 116.2 bits, E=9.2e-38

Best Hits

Swiss-Prot: 100% identical to GALU2_PSEAI: UTP--glucose-1-phosphate uridylyltransferase (galU) from Pseudomonas aeruginosa

KEGG orthology group: K00963, UTP--glucose-1-phosphate uridylyltransferase [EC: 2.7.7.9] (inferred from 100% identity to pfs:PFLU2985)

Predicted SEED Role

"UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9)" (EC 2.7.7.9)

MetaCyc Pathways

• UDP-α-D-glucose biosynthesis (2/2 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• sucrose degradation II (sucrose synthase) (4/5 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• sucrose biosynthesis II (6/8 steps found)
• colanic acid building blocks biosynthesis (8/11 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• stachyose degradation (2/7 steps found)
• type I lipoteichoic acid biosynthesis (S. aureus) (4/17 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism
• Pentose and glucuronate interconversions
• Starch and sucrose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.9

Sequence Analysis Tools

See A0A1N7U3Y6 at UniProt or InterPro

Protein Sequence (279 amino acids)

>PS417_14065 UTP--glucose-1-phosphate uridylyltransferase (Pseudomonas simiae WCS417)
MIKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYGVEEALDAGLNEISIVTGRGKR
ALEDHFDISYELENQIKGTDKEKYLVGIRKLLDECSFSYTRQTQMKGLGHAILTGRPLIG
DEPFAVVLADDLCVNLEGDGVLTQMVKLYQKYRCTIVAVMEVNPTETNKYGVIAGDDIGD
GLIRVRDMVEKPAPEDAPSNLAIIGRYILTPDIFKLIEETEPGKGGEIQITDALLKQAKD
GCVIAYKFKGQRFDCGGAEGYIEATNFCYEHFYKTGKAY