Protein Info for GFF2755 in Variovorax sp. SCN45

Annotation: Ribosyl nicotinamide transporter, PnuC-like

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 transmembrane" amino acids 15 to 35 (21 residues), see Phobius details amino acids 41 to 59 (19 residues), see Phobius details amino acids 79 to 99 (21 residues), see Phobius details amino acids 106 to 123 (18 residues), see Phobius details amino acids 130 to 147 (18 residues), see Phobius details amino acids 153 to 171 (19 residues), see Phobius details PF04973: NMN_transporter" amino acids 2 to 173 (172 residues), 167.9 bits, see alignment E=1.1e-53 TIGR01528: nicotinamide mononucleotide transporter PnuC" amino acids 20 to 173 (154 residues), 80.6 bits, see alignment E=7.2e-27

Best Hits

KEGG orthology group: K03811, nicotinamide mononucleotide transporter (inferred from 91% identity to vpe:Varpa_2165)

Predicted SEED Role

"Ribosyl nicotinamide transporter, PnuC-like" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation or PnuC-like transporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (181 amino acids)

>GFF2755 Ribosyl nicotinamide transporter, PnuC-like (Variovorax sp. SCN45)
VLALAMVGCNMREIHWGWPLAIVSSLLYMAVFAKARIYGDASLQVFFAFVALWGWTQWLR
GHRADGSALHVSRLSPRGIALTLAACALAWPAIALFLRRFTDTDVPWWDGFATGLSLVGQ
FLLGRKFIENWLIWLAVNVVSVGLFIHKGLWLTVGLYAVFAALSVAGYLAWRQRLPQAAR
A