Protein Info for GFF2751 in Xanthobacter sp. DMC5

Annotation: Iron-uptake system permease protein FeuC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 29 to 47 (19 residues), see Phobius details amino acids 82 to 102 (21 residues), see Phobius details amino acids 113 to 133 (21 residues), see Phobius details amino acids 139 to 157 (19 residues), see Phobius details amino acids 165 to 186 (22 residues), see Phobius details amino acids 206 to 227 (22 residues), see Phobius details amino acids 255 to 281 (27 residues), see Phobius details amino acids 287 to 311 (25 residues), see Phobius details amino acids 320 to 343 (24 residues), see Phobius details PF01032: FecCD" amino acids 38 to 344 (307 residues), 244.5 bits, see alignment E=7e-77

Best Hits

Swiss-Prot: 42% identical to CBRC_DICD3: Achromobactin transport system permease protein CbrC (cbrC) from Dickeya dadantii (strain 3937)

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 64% identity to azc:AZC_0185)

Predicted SEED Role

"putative permease of ferrichrome ABC transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (349 amino acids)

>GFF2751 Iron-uptake system permease protein FeuC (Xanthobacter sp. DMC5)
MRTVARAAGYRLFSAGPVSLRLRPRAAGVAAALVALICAGTAFALASGSLHIPLRSVMAA
LLGGDVPPEVAHVVTGVRLPRVVLALLAGAMLGLSGAALQALTRNGLADPGLVGVKEGAS
LAVLVLILAFPALGAAWRLPVGMAGGLAVALAVVLIARDLSGVRFVLVGIGVSWLLASAL
LVFITTADINDVETALVWLAGSLHAAEWTLIPALAVWGALGAGALFATARAADAALLGDD
AATGLGVRLERTGMIGLAAPVLMTAAAVSCVGSLGFVGLIAPHMARLVVGGGQAAVLAAS
GLLGAALVLGADTAGRLLFAPLQIPAGIVMTLAGVPLFLFLLWRRRDQI