Protein Info for GFF2750 in Xanthobacter sp. DMC5

Annotation: putative siderophore transport system permease protein YfiZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 73 to 94 (22 residues), see Phobius details amino acids 106 to 130 (25 residues), see Phobius details amino acids 142 to 161 (20 residues), see Phobius details amino acids 171 to 192 (22 residues), see Phobius details amino acids 212 to 235 (24 residues), see Phobius details amino acids 259 to 286 (28 residues), see Phobius details amino acids 300 to 320 (21 residues), see Phobius details amino acids 329 to 348 (20 residues), see Phobius details PF01032: FecCD" amino acids 31 to 349 (319 residues), 273.9 bits, see alignment E=8e-86

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 64% identity to azc:AZC_0184)

Predicted SEED Role

"Putative iron compound permease protein of ABC transporter family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (352 amino acids)

>GFF2750 putative siderophore transport system permease protein YfiZ (Xanthobacter sp. DMC5)
VSLAVTGLATTRPRRRLARPVLIASGLMLLLVGLAIAHLGFGARAIAPEVVVRALIAFDA
DSFDHNVIVELRLLRLLAALVVGAGLGLTGALIQSVTRNPLGEPHVLGLNAGAALAVVTT
LTLSSVLGPLLPASALAATRPLVAGLGAMLLCAAVLGVAALGRTGMTPLKVTLCGVAFSA
FAAALTSAQLLLDDQTLATVRLWLAGDLSGLSYGALWAALPPAIAGLALALVLAGRLDAL
AMGDQMAAGLGIHVARTRLMALVAAGLLCGAAVSLAGPIGFVGLVVPHAVKALGVRDMRV
VLPLSALAGAALLVAADLAARSLFAPRELATGIVTALVGVPVFIALAARRRP