Protein Info for GFF2749 in Xanthobacter sp. DMC5

Annotation: putative siderophore transport system ATP-binding protein YusV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 PF00005: ABC_tran" amino acids 34 to 182 (149 residues), 116.7 bits, see alignment E=1.9e-37 PF13555: AAA_29" amino acids 37 to 70 (34 residues), 27.4 bits, see alignment 3.5e-10

Best Hits

Swiss-Prot: 48% identical to CBRD_DICD3: Achromobactin transport ATP-binding protein CbrD (cbrD) from Dickeya dadantii (strain 3937)

KEGG orthology group: K02013, iron complex transport system ATP-binding protein [EC: 3.6.3.34] (inferred from 69% identity to azc:AZC_0183)

MetaCyc: 44% identical to ferric enterobactin ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-10-RXN [EC: 7.2.2.17]

Predicted SEED Role

"transport; Transport of small molecules: Cations"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.34

Use Curated BLAST to search for 3.6.3.34 or 7.2.2.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (279 amino acids)

>GFF2749 putative siderophore transport system ATP-binding protein YusV (Xanthobacter sp. DMC5)
VRNTARAEDVTGAEAVRLRIDTLKAGYGQRLVVDGVSFTVAAGRMTALIGPNGSGKSTLL
ATMARLLQPMGGTVLLDGRAVHGQPTRALARELGLLPQSPLVPEGLTAYELVSRGRHPHQ
GFLSQWSDADDAAVEEAMHLTGTRDFAATPVAALSGGQRQRCWIAMAMAQQTSVILLDEP
TTFLDLRYQVEVLDLLARLARDLGRTVVVVLHDLNMALAYADTVLCLKDGRIRAVAGEGR
SLAAADVADIFGVEVEALIHPRTGKPVFVPLGAARGAGT