Protein Info for PS417_14010 in Pseudomonas simiae WCS417

Annotation: multidrug transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 37 to 58 (22 residues), see Phobius details amino acids 70 to 92 (23 residues), see Phobius details amino acids 98 to 119 (22 residues), see Phobius details amino acids 126 to 144 (19 residues), see Phobius details amino acids 157 to 177 (21 residues), see Phobius details amino acids 189 to 211 (23 residues), see Phobius details amino acids 224 to 243 (20 residues), see Phobius details amino acids 255 to 273 (19 residues), see Phobius details amino acids 279 to 296 (18 residues), see Phobius details PF00892: EamA" amino acids 13 to 142 (130 residues), 88.3 bits, see alignment E=2.9e-29 amino acids 158 to 295 (138 residues), 86.2 bits, see alignment E=1.3e-28

Best Hits

KEGG orthology group: None (inferred from 82% identity to pfs:PFLU2996)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UC79 at UniProt or InterPro

Protein Sequence (307 amino acids)

>PS417_14010 multidrug transporter (Pseudomonas simiae WCS417)
MHSSSDRITYMKLAAVTMIWGGTFVAGRYLSGTVDPLLAASLRFALASLALLGFLGLARI
PLARPSPRQLLQLGMLGFFGIFFYNLCFFYGLQSINASRASLIVALNPAVIGLASRWLFK
ERLGASNVAGILLCLTGAAVVIVSRNPHVLNEATSSWRGDLLIFGCVVGWGIYSLFSRGL
NQSLGPLQTVTWSILLGTLMLTLTTLIMGRFTLEAMGRLQTAQGLSLAYLGVLGSALAYI
GYYDGIRRIGATRSGVFIALNPLTAVICGALLLDEPLSLPMLIGGAVILLGIYLCNKPLA
RARAMGI