Protein Info for GFF2745 in Xanthobacter sp. DMC5

Annotation: Iron(3+)-hydroxamate import ATP-binding protein FhuC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 PF00005: ABC_tran" amino acids 32 to 160 (129 residues), 84.4 bits, see alignment E=1.2e-27

Best Hits

Swiss-Prot: 32% identical to THIQ_SHIF8: Thiamine import ATP-binding protein ThiQ (thiQ) from Shigella flexneri serotype 5b (strain 8401)

KEGG orthology group: K02013, iron complex transport system ATP-binding protein [EC: 3.6.3.34] (inferred from 54% identity to ara:Arad_9190)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.34

Use Curated BLAST to search for 3.6.3.34

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (250 amino acids)

>GFF2745 Iron(3+)-hydroxamate import ATP-binding protein FhuC (Xanthobacter sp. DMC5)
MSEALGVRLVDVGAAYGRTPVLAGITTPRFAGGDLVAVLGLNGSGKSTLLKRMAGLLTGP
GRVELSGASRDDIGYLPQDHSSPAGLTVYESVLLSARRDAGWSVSTAELSRVDATLAMLG
LTPLAFRGLDTLSGGQRQLASIAQALVRQPRILLMDEPTSALDLHRQFEILKILRRLAQR
QGVIVFVSLHDVNLALRFTSHAMVMANGKLVACGSSSTIISTEMMGSVFRVAARVETCSK
GGAFVIVDDD