Protein Info for PS417_14000 in Pseudomonas simiae WCS417

Annotation: chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 transmembrane" amino acids 5 to 22 (18 residues), see Phobius details amino acids 33 to 51 (19 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 102 to 119 (18 residues), see Phobius details amino acids 126 to 143 (18 residues), see Phobius details amino acids 149 to 166 (18 residues), see Phobius details amino acids 177 to 193 (17 residues), see Phobius details amino acids 209 to 229 (21 residues), see Phobius details amino acids 236 to 258 (23 residues), see Phobius details amino acids 268 to 287 (20 residues), see Phobius details TIGR00688: protein RarD" amino acids 3 to 255 (253 residues), 189.3 bits, see alignment E=4.3e-60

Best Hits

Swiss-Prot: 42% identical to RARD_PSEAE: Chloramphenicol-sensitive protein RarD (rarD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K05786, chloramphenicol-sensitive protein RarD (inferred from 96% identity to pfs:PFLU2998)

Predicted SEED Role

"Protein rarD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7ULA6 at UniProt or InterPro

Protein Sequence (293 amino acids)

>PS417_14000 chemotaxis protein (Pseudomonas simiae WCS417)
MSKGVVLSVLASVLFAVMYYFTSLLTPLSGLEIFGWRMLLTVPCMTVFMIVSGEWRRVWE
LLQLLAAKPRLIAGVLLSSALLGVQLWLFMWAPLNGRSLDVSVGYFLLPLTMVLTGRLVW
GEQLSYLQRIAVFFAALGVLNELYQAGGFSWATLVVIIGYPVYFIVRKYLKTDHLGGLWL
DMALMLPVAWWFVQSGEQGFAVMDAHPKLYALIPMLGLISASALVSYIIASRLLAFSLFG
LLSYVEPVLLLAVALILGEGIKGGEWLTYIPIWLAVMVLVFEGFKHLVHQRKT