Protein Info for GFF2744 in Xanthobacter sp. DMC5

Annotation: Vitamin B12 import system permease protein BtuC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 transmembrane" amino acids 37 to 61 (25 residues), see Phobius details amino acids 81 to 104 (24 residues), see Phobius details amino acids 118 to 142 (25 residues), see Phobius details amino acids 148 to 168 (21 residues), see Phobius details amino acids 179 to 201 (23 residues), see Phobius details amino acids 221 to 240 (20 residues), see Phobius details amino acids 272 to 295 (24 residues), see Phobius details amino acids 309 to 328 (20 residues), see Phobius details amino acids 336 to 357 (22 residues), see Phobius details PF01032: FecCD" amino acids 44 to 358 (315 residues), 269.1 bits, see alignment E=2.3e-84

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 64% identity to hel:HELO_4155)

Predicted SEED Role

"Iron(III) dicitrate transport system permease protein FecD (TC 3.A.1.14.1)" (TC 3.A.1.14.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (364 amino acids)

>GFF2744 Vitamin B12 import system permease protein BtuC (Xanthobacter sp. DMC5)
MSAPPHGAGLPLQVPASATLDLAAIYRRRTHRKQASLLLMVTSLLCSMMLDLAVGPAGYF
LADIVHALIAPASSPPEVRAILWTIRMPTALMAGVVGASLAVAGAQMQTVLANPLASPFT
LGISAAAGFGAAIALAFGVAIVPAFLEYVVPLNALLMALLAAGLIHAFSLQRGATTESIV
LLGIALVFSFNALLTLVQFFASEQAVAAVVFWTMGSLTKVTWAKLGISTVVLAGVLPVFV
RRAWSLTCLRLGEDKAGSLGVNVRHLKLETMALVALLAAVPVAFVGTIGFVGLVGPHIAR
LLIGEDQRFFLPASALCGAVLLSASSILSKTLIPGTLLPIGIVTAIIGVPFFLLLILRSV
RTRP