Protein Info for GFF2742 in Sphingobium sp. HT1-2

Annotation: Transcriptional repressor of ectoine biosynthetic genes

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 PF12802: MarR_2" amino acids 36 to 94 (59 residues), 51.8 bits, see alignment E=7.4e-18 PF01047: MarR" amino acids 37 to 94 (58 residues), 45.9 bits, see alignment E=4.3e-16

Best Hits

KEGG orthology group: None (inferred from 64% identity to npp:PP1Y_AT8675)

Predicted SEED Role

"Putative regulatory protein associated with the ectoine operon" in subsystem Ectoine biosynthesis and regulation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (166 amino acids)

>GFF2742 Transcriptional repressor of ectoine biosynthetic genes (Sphingobium sp. HT1-2)
MRLPMDSEIASLTLRALRRVLRATEIGSRQLATTTGLTPSQLLVLREIDTRLSVTPSAVA
QALQFSQATITAIVDRLVALGFVQRQRGERDKRQIHLTLLPAGRDALADAPDPLQKRFTD
RFDALPTWEQAMILAATERLAMLMDADSIDAAPLLDSGRIDRSEPL