Protein Info for GFF2741 in Xanthobacter sp. DMC5

Annotation: Ferrichrome outer membrane transporter/phage receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 686 PF07715: Plug" amino acids 36 to 140 (105 residues), 84.3 bits, see alignment E=8.5e-28 TIGR01783: TonB-dependent siderophore receptor" amino acids 37 to 680 (644 residues), 350.6 bits, see alignment E=9.7e-109 PF00593: TonB_dep_Rec_b-barrel" amino acids 214 to 655 (442 residues), 193.7 bits, see alignment E=1.1e-60

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 59% identity to rpa:RPA3414)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (686 amino acids)

>GFF2741 Ferrichrome outer membrane transporter/phage receptor (Xanthobacter sp. DMC5)
MLGTVVVDATDGESASNETIVARRDASSTKTETPIVETPQSVDVITRKQLDDQNPQTVGN
ALQYTAGVFTPDATTRFDGLFIRGFGGFGTSTTFVSFMDGLRLPRGQAFGQFQIDPYLLE
RIDVLKGPSAVLYGQVSPGGLVNMVSRDPSASPYNELRFEAGSYGRAQVGLTTQGAFDDK
GVWQYSLSAIGRISGTPYEGVSEQRVGVAPALAWQPDADTRLTLRAFYENDPEGGYFNSI
YPTFLSPPKYRSFLNRNFNVGDPTFDSYNREQGGIGYSFEHRFNDFVEIRSSTRYTDVSA
ETRGIQMAGAMTSGGILPRQAVISTEQAGGIATDNNVVFTFATGALSHKVVAGVDYQSFS
SDWTYQWGLAPSLNVVFPVYGVTPGPFFTLIDNTQTVQQTGLYLQDQIAVGNWRAVLGVR
QDWTSQQTENYLAGGAMSDQSASAATYRAALLYLFDNGLAPYASYATSFEPVIGVDVQGQ
PFIPTEAEQFEVGLKYQPTFMNALFTVSAFDIRQQNVLTPGPVLGFNVQTGEIRSRGLEF
EARADLSANLEMIGAMTLLNAEVTASSVASYIGKHPQAVPNYFGSLWLNYKFTDGALAGL
TTGAGLRVIGPSYADDANLIKVDGFALIDLSLRYDLAMLSPQMKGAIATLDVRNLFDTVY
YTSCTYDIYCQYGSARTFLAGLRKTW