Protein Info for GFF2741 in Sphingobium sp. HT1-2

Annotation: L-2,4-diaminobutyric acid acetyltransferase (EC 2.3.1.178)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02406: diaminobutyrate acetyltransferase
  • amino acids 1 to 141 (141 residues), 175.9 bits, E=2.9e-56
• PF00583: Acetyltransf_1
  • amino acids 20 to 104 (85 residues), 50.9 bits, E=1.8e-17
• PF13508: Acetyltransf_7
  • amino acids 25 to 91 (67 residues), 28.3 bits, E=1.9e-10

Best Hits

Swiss-Prot: 51% identical to ECTA_META2: L-2,4-diaminobutyric acid acetyltransferase (ectA) from Methylomicrobium alcaliphilum (strain DSM 19304 / NCIMB 14124 / VKM B-2133 / 20Z)

KEGG orthology group: K06718, L-2,4-diaminobutyric acid acetyltransferase [EC: 2.3.1.178] (inferred from 64% identity to npp:PP1Y_AT4594)

Predicted SEED Role

"L-2,4-diaminobutyric acid acetyltransferase (EC 2.3.1.-)" in subsystem Ectoine biosynthesis and regulation (EC 2.3.1.-)

MetaCyc Pathways

• ectoine biosynthesis (5/5 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycine, serine and threonine metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.178

Protein Sequence (147 amino acids)

>GFF2741 L-2,4-diaminobutyric acid acetyltransferase (EC 2.3.1.178) (Sphingobium sp. HT1-2)
LIAACPPLDRNSAYCNLLQCTDFAGSCIVAERGGAVVGWVSGYRPPAAPDNFFVWQVAVS
SAARGQRLAGRMIEALLARPEQAGVAHLTTTITDDNRASWALFQGLARRWGVRIEKTARF
EEQAHFAGAHATEWQARIGPLPTLAQI