Protein Info for GFF2738 in Sphingobium sp. HT1-2

Annotation: Ectoine hydroxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 TIGR02408: ectoine hydroxylase" amino acids 17 to 290 (274 residues), 391.8 bits, see alignment E=8.5e-122 PF05721: PhyH" amino acids 41 to 256 (216 residues), 119 bits, see alignment E=1.9e-38

Best Hits

Swiss-Prot: 78% identical to ECTD_SPHAL: Ectoine dioxygenase (ectD) from Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)

KEGG orthology group: K10674, ectoine hydroxylase [EC: 1.14.11.-] (inferred from 78% identity to sal:Sala_2952)

Predicted SEED Role

"Ectoine hydroxylase (EC 1.17.-.-)" in subsystem Ectoine biosynthesis and regulation (EC 1.17.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.11.-

Use Curated BLAST to search for 1.14.11.- or 1.17.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>GFF2738 Ectoine hydroxylase (Sphingobium sp. HT1-2)
MKDLYPSRHADMAEFLPRHDPVVHADWSAGAPISRDQADAFDRDGYLVLEDIFSDAEVAF
LQHEARKLLADPDALEAETVITEPGGKEVRSIFRIHAQSRVIERLAADSRLAGVARFLLG
DDVYIHQSRLNYKPGFQGKEFYWHSDFETWHVEDGMPRMRALSMSVLLAENTPHNGPLML
IPGSHRQYLTCVGETPEDHYRQSLKRQEYGVPDEDSLAELAHHHGIVAPTGKPGSVVIFD
CNIMHGSNGNITPFPRANAFLVYNAVSNRLEAPFGVDRPRPAFIAARGEPPVITPITGPL
MQEALA