Protein Info for GFF2734 in Sphingobium sp. HT1-2

Annotation: Miniconductance mechanosensitive channel YbdG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 transmembrane" amino acids 23 to 45 (23 residues), see Phobius details amino acids 66 to 88 (23 residues), see Phobius details amino acids 99 to 125 (27 residues), see Phobius details amino acids 145 to 164 (20 residues), see Phobius details amino acids 170 to 187 (18 residues), see Phobius details PF00924: MS_channel_2nd" amino acids 189 to 257 (69 residues), 55.2 bits, see alignment E=6.2e-19 PF21082: MS_channel_3rd" amino acids 335 to 399 (65 residues), 21.8 bits, see alignment E=2.1e-08

Best Hits

KEGG orthology group: None (inferred from 60% identity to pzu:PHZ_c1333)

Predicted SEED Role

"Small-conductance mechanosensitive channel"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (418 amino acids)

>GFF2734 Miniconductance mechanosensitive channel YbdG (Sphingobium sp. HT1-2)
MISQLYIASDSLQILTRGYVENVWLQAVTGLLLLGAFAWAANWVAKRIVLTLLLRLIDHL
PFRVEAAHIGAVVARLSNIVPALIIQSGVAAVPHLPVRLAGFIASLSTAFIILTLAIALS
GLLTLGNDLYQRRPDAANRPIKGYVQVAKLLVYGAASILMIAALMDQSPLLLLSGLGAMA
AVLMLVFKDTILSLVASVQIGSNDMIRVGDWIEMPQLDANGDVIDIALHTVKVQNFDRTI
TTIPTHRLISESFRNWRGMQESGGRRIMRALVIDQNSVGFLDEPGFDAVARFGLLRTYLH
DKQHDLSRWNGDHAAGNRLDGRRLTNIGTFRAYVLAYLRAHPDIRPDQTLLVRQLAPSGH
GLPLEIYAFANTIVWAEYEGIQADIFDHLIAILPEFGLRLFQRPAGSDLGQLMSGTRI