Protein Info for GFF2732 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 656 transmembrane" amino acids 79 to 101 (23 residues), see Phobius details amino acids 121 to 143 (23 residues), see Phobius details amino acids 201 to 223 (23 residues), see Phobius details amino acids 235 to 260 (26 residues), see Phobius details amino acids 327 to 344 (18 residues), see Phobius details amino acids 360 to 375 (16 residues), see Phobius details PF05992: SbmA_BacA" amino acids 81 to 395 (315 residues), 62.8 bits, see alignment E=6e-21 PF06472: ABC_membrane_2" amino acids 83 to 348 (266 residues), 129.2 bits, see alignment E=3e-41 PF00005: ABC_tran" amino acids 443 to 576 (134 residues), 78.1 bits, see alignment E=1.5e-25

Best Hits

KEGG orthology group: K02471, putative ATP-binding cassette transporter (inferred from 88% identity to xau:Xaut_4366)

Predicted SEED Role

"FIG00442849: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (656 amino acids)

>GFF2732 hypothetical protein (Xanthobacter sp. DMC5)
MTTAEAPARPTEKPDATAESELDSVIAENGKVVEPHPPEAIEPDPSLAPEEVERLRKSYL
LKRFWISARGYWGAKGDKLAWVFTIGLLLLIVTNVGFQYAINVWNRSIFDGIEKRDASTV
FFLTAVFFPLAVGSVALGVAQVYARMGMQRRWRAWLTNAVVSRWLTGGRYYQLNLVSGDH
KNPEYRIAEDLRVATEAPVDFLAGVTSAFLSAATFIVVLWTIGGALTVTLGGTAITIPGF
LVVAAVIYALIASGSILFIGRRFVEVSEEKNQSEADYRYVLTRVRENGESIALLGGEQEE
REGINSTFSGVLRQWSRLAGQYMRTTLVSQGSSLIAPVVPLLLCAPKFLEGQMSLGEVMQ
AASAFTIVQTAFGWLVDNYPRLADWNACARRIASLMMSLDALERAENGDGVGRIQRGETD
GRAMLTLNDLSVSLDDGTAVVDQAEVVIEPGERLFVSGASGSGKSTLVRAIAGLWPWGSG
SINFHPDARLFMLPQKPYVPSGTLRRAAAYPGGAEDWSAEEIGAALSAVGLDHLKEKIEE
DAPWDQTLSGGEKQRLAFARLLLHRPDIIVLDEATSALDDKSQDGMMELVTTELPDATIV
SVAHRTELEAFHSRKIVLERRKGGAKLVTDIDLIPRKGKPRLLGQLLRRRRPSSRV