Protein Info for GFF2730 in Sphingobium sp. HT1-2

Annotation: Hexuronate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 transmembrane" amino acids 18 to 43 (26 residues), see Phobius details amino acids 77 to 102 (26 residues), see Phobius details amino acids 109 to 129 (21 residues), see Phobius details amino acids 162 to 181 (20 residues), see Phobius details amino acids 201 to 221 (21 residues), see Phobius details amino acids 233 to 276 (44 residues), see Phobius details amino acids 289 to 314 (26 residues), see Phobius details amino acids 320 to 340 (21 residues), see Phobius details PF00083: Sugar_tr" amino acids 4 to 131 (128 residues), 29.3 bits, see alignment E=4.2e-11 PF07690: MFS_1" amino acids 5 to 306 (302 residues), 148.4 bits, see alignment E=2.6e-47

Best Hits

Predicted SEED Role

"Hexuronate transporter" in subsystem Alginate metabolism or D-Galacturonate and D-Glucuronate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (357 amino acids)

>GFF2730 Hexuronate transporter (Sphingobium sp. HT1-2)
MYLGGGWLLDRVGTRRGFLAIMIFWSLACASHGVAGGIAALVVSRLLLGIGEGGGFPAAT
RAIAEWFPPERRAAAMGLVNAGTAVGAVVAPPLIAGILAYGHWFDLASWRWVFFITGGFG
LAWALWWFLTYRTPAGDVVSAGEDAGLAPTVAMLLARREVRGLVGAKFLSDGAWYFYLFW
LPKYLFEAHGFDLKQAATIGWIPYAASGVGSLCGGWLSSRLLSAGRSVDAARKIALGLSA
ACMPWVMLAPATASVAAVIGIFSLAFFGQQSWSTLVMTLPTDLAPRSALGRLAGLVGLGG
AFGGIVMGQAAGWALDAGLGYAPVLTVAATLHLIAFALICRSIPRISPLSFTRKVVP