Protein Info for GFF2729 in Sphingobium sp. HT1-2

Annotation: L-lyxonate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02746: MR_MLE_N
  • amino acids 41 to 137 (97 residues), 48.5 bits, E=9.7e-17
• PF13378: MR_MLE_C
  • amino acids 159 to 379 (221 residues), 203 bits, E=5.3e-64

Best Hits

KEGG orthology group: None (inferred from 74% identity to sus:Acid_5323)

MetaCyc: 60% identical to L-lyxonate dehydratase (Pseudomonas aeruginosa PAO1)
RXN-15590 [EC: 4.2.1.176]

Predicted SEED Role

"O-succinylbenzoate synthase (EC 4.2.1.113)" (EC 4.2.1.113)

MetaCyc Pathways

• L-lyxonate degradation (2/3 steps found)
• superpathway of chorismate metabolism (41/59 steps found)
• 2-carboxy-1,4-naphthoquinol biosynthesis (3/7 steps found)
• superpathway of menaquinol-8 biosynthesis I (5/10 steps found)
• superpathway of demethylmenaquinol-8 biosynthesis I (4/9 steps found)
• superpathway of menaquinol-10 biosynthesis (4/10 steps found)
• superpathway of menaquinol-11 biosynthesis (4/10 steps found)
• superpathway of menaquinol-12 biosynthesis (4/10 steps found)
• superpathway of menaquinol-13 biosynthesis (4/10 steps found)
• superpathway of menaquinol-6 biosynthesis (4/10 steps found)
• superpathway of menaquinol-7 biosynthesis (4/10 steps found)
• superpathway of menaquinol-9 biosynthesis (4/10 steps found)
• superpathway of demethylmenaquinol-6 biosynthesis I (3/9 steps found)
• superpathway of demethylmenaquinol-9 biosynthesis (3/9 steps found)
• superpathway of phylloquinol biosynthesis (4/15 steps found)

KEGG Metabolic Maps

• Ubiquinone and menaquinone biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.113 or 4.2.1.176

Protein Sequence (388 amino acids)

>GFF2729 L-lyxonate dehydratase (Sphingobium sp. HT1-2)
LKITEIRTRVVQWEGETVPLPPHFCTNPMDMVSPMLSPETMGTFTFHGWLIVEIFTDQGL
VGIGNAALAPFVTKQLIDQYLAPLLIGQDPWDSEFLWQHMYRKTMAFGRKGVALVAISAL
DILMGKAAKQPVFRLLGGRTKAKIPVYASRLYSIPLDELAQEAAAYKAQGYKAMKLRFGW
GPIDGAEGMARNVELIRTVRETVGDEIDIMADAYMGWSLDYAKRMMRLIEPFNLRWLEEA
IIPDDINGYHELRRFGTTPIAAGEHEFTSYGFRQMIEAKSLDYFQFDTNRVGGITAARKI
QALAEAYSIPVVPHAGQMHNYHVVMASLNSPIAEYFPMVDVEVGNELFWYIFKGEPQAVD
GHIDLDDNLPGLGLEIDEAALSRFKVIG