Protein Info for GFF2728 in Sphingobium sp. HT1-2

Annotation: 3-hydroxyisobutyrate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03446: NAD_binding_2
  • amino acids 1 to 147 (147 residues), 118.7 bits, E=2.6e-38
• PF14833: NAD_binding_11
  • amino acids 150 to 269 (120 residues), 85 bits, E=5.1e-28

Best Hits

Swiss-Prot: 34% identical to GLYR1_ARATH: Glyoxylate/succinic semialdehyde reductase 1 (GLYR1) from Arabidopsis thaliana

KEGG orthology group: None (inferred from 42% identity to aex:Astex_2463)

MetaCyc: 34% identical to NAD-dependent succinate semialdehyde dehydrogenase (Solanum lycopersicum)
Succinate-semialdehyde dehydrogenase. [EC: 1.2.1.24]

Predicted SEED Role

"2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60)" in subsystem Allantoin Utilization or D-galactarate, D-glucarate and D-glycerate catabolism or Photorespiration (oxidative C2 cycle) (EC 1.1.1.60)

MetaCyc Pathways

• 4-aminobutanoate degradation I (1/2 steps found)
• 4-aminobutanoate degradation IV (1/3 steps found)
• N-methylpyrrolidone degradation (1/3 steps found)
• superpathway of 4-aminobutanoate degradation (1/3 steps found)
• D-glucarate degradation I (1/4 steps found)
• D-galactarate degradation I (1/4 steps found)
• GABA shunt I (1/4 steps found)
• GABA shunt II (1/4 steps found)
• glycolate and glyoxylate degradation I (1/4 steps found)
• superpathway of glycol metabolism and degradation (3/7 steps found)
• superpathway of D-glucarate and D-galactarate degradation (1/5 steps found)
• superpathway of L-arginine and L-ornithine degradation (5/13 steps found)
• superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (3/11 steps found)
• superpathway of microbial D-galacturonate and D-glucuronate degradation (13/31 steps found)

KEGG Metabolic Maps

• Butanoate metabolism
• Glutamate metabolism
• Glyoxylate and dicarboxylate metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.60, 1.2.1.24

Use Curated BLAST to search for 1.1.1.60 or 1.2.1.24

Protein Sequence (273 amino acids)

>GFF2728 3-hydroxyisobutyrate dehydrogenase (Sphingobium sp. HT1-2)
MARQLLAAGFDLTMWNRSAGKAEALRAAGGRVAATPADAVQHADIVIAMLANDDVSKTVW
TGEDGALAAMKAGAIAIESSTLTGDWVFDLARQAVARGVRFLEAPVTGSRDQAAQGTLRF
LVGGDAAAIELARPAFDAMGGALVHLGPVGSAATVKLANNYLCGVQAASLAEAIALFEKH
GLDIEQAMSILFDGAPASPMVKGVGRRMLDRDYAPHFVVPLMAKDLGYAAQALADVGIVS
AIAQAARQRFIDADLVGEGDRDIAAIVEPLRKA