Protein Info for GFF2727 in Xanthobacter sp. DMC5

Annotation: Inner membrane ABC transporter permease protein YdcV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 70 to 94 (25 residues), see Phobius details amino acids 106 to 130 (25 residues), see Phobius details amino acids 136 to 160 (25 residues), see Phobius details amino acids 192 to 214 (23 residues), see Phobius details amino acids 235 to 259 (25 residues), see Phobius details PF00528: BPD_transp_1" amino acids 86 to 248 (163 residues), 47.7 bits, see alignment E=7.9e-17

Best Hits

Swiss-Prot: 33% identical to POTC_HAEIN: Spermidine/putrescine transport system permease protein PotC (potC) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 38% identity to ppm:PPSC2_c5094)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (262 amino acids)

>GFF2727 Inner membrane ABC transporter permease protein YdcV (Xanthobacter sp. DMC5)
MAISRSSASPGIGSRFFAAFVVLFLMGPIIIAGIVAFSSGDRLEFPIPGFSLRWFVVALQ
TPQYIEGLTVSVIIGLGNALLATIAGTGAAIALHRYRFRGRSAVQALVMLPIAMPAIVLG
LGLLFTLAVYDMRPGILAATLGHAVLGVPYVVAMVSAALANHDGSLERASMNLGVGPVGT
FFRVTLPMIRGGVIAGAVSAFLISFDNFSLSLFITRGDTLPLRLMQQLLAYADPSVAAIS
TLLVFASLAGMAALLPLALRGR