Protein Info for PS417_01385 in Pseudomonas simiae WCS417

Annotation: NAD-dependent dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05368: NmrA
  • amino acids 5 to 121 (117 residues), 31.3 bits, E=6.5e-11
• PF04321: RmlD_sub_bind
  • amino acids 5 to 238 (234 residues), 50.8 bits, E=5.4e-17
• PF01370: Epimerase
  • amino acids 6 to 243 (238 residues), 228 bits, E=4.8e-71
• PF02719: Polysacc_synt_2
  • amino acids 6 to 258 (253 residues), 58.5 bits, E=2.5e-19
• PF01073: 3Beta_HSD
  • amino acids 7 to 231 (225 residues), 85.4 bits, E=1.4e-27
• PF16363: GDP_Man_Dehyd
  • amino acids 7 to 260 (254 residues), 178.5 bits, E=1e-55
• PF13460: NAD_binding_10
  • amino acids 10 to 157 (148 residues), 52.2 bits, E=3e-17
• PF07993: NAD_binding_4
  • amino acids 63 to 192 (130 residues), 28.6 bits, E=3.3e-10

Best Hits

KEGG orthology group: K01784, UDP-glucose 4-epimerase [EC: 5.1.3.2] (inferred from 71% identity to pfl:PFL_2971)

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• colanic acid building blocks biosynthesis (8/11 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-α-D-galactofuranose biosynthesis (1/2 steps found)
• D-galactose degradation I (Leloir pathway) (3/5 steps found)
• D-galactose detoxification (1/3 steps found)
• stachyose degradation (2/7 steps found)
• UDP-sugars interconversion (2/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (1/18 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2

Sequence Analysis Tools

See U1SZA6 at UniProt or InterPro

Protein Sequence (310 amino acids)

>PS417_01385 NAD-dependent dehydratase (Pseudomonas simiae WCS417)
MAVGRILVTGGAGFIGSHLVEALLGKGYKIRVLDNLSTGKVANLPVAHPDLELMIGDVAD
SAVVEQAMADCSAVVHLAAVASVQASVDDPVATHQANFVGTLNVCQSMLKAGVTRVVFAS
SAATYGNNGEGTAIAEDTPKSPLTPYASDKLASEYYLDFYRREHGLEPVIFRFFNIFGPR
QDPSSPYSGVISIFTERALAGKPITVFGDGEQTRDFVYVQDLVSILVQAVETREPAPEAI
NVGLSRSTSLNDLIAELGNATGTALNVTYQAPRQGDIRHSRANNTRLLERFALPQPTSIG
QGLAQLLRSL