Protein Info for GFF2718 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: 21 kDa hemolysin precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF04972: BON" amino acids 55 to 122 (68 residues), 35.2 bits, see alignment E=6.5e-13 amino acids 132 to 197 (66 residues), 50.3 bits, see alignment E=1.2e-17

Best Hits

Swiss-Prot: 38% identical to YRAP_ECOLI: Uncharacterized protein YraP (yraP) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 61% identity to aaa:Acav_0603)

Predicted SEED Role

"21 kDa hemolysin precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (219 amino acids)

>GFF2718 21 kDa hemolysin precursor (Hydrogenophaga sp. GW460-11-11-14-LB1)
MNRTDTPSFHRIAAAALAVAALGATLSACAPLVVGGAAVTALVAVDRRTSGAQLDDQGIE
LRASNRLKDELGDAHARYAISSYNRRVLITGEASSEAVKTKVTQIVTGVENVREVINELG
VTNSPSLKERASDTLITGRVKASLVDAKDLTASAFKVVTERGTVYLMGRVTQREADRATD
IARNTQSVSRVVRVFEIISEQELVNIGAAKQPAPTNPTK