Protein Info for GFF2717 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: YciK-like oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 14 to 210 (197 residues), 184.1 bits, E=4.1e-58
• PF01370: Epimerase
  • amino acids 15 to 199 (185 residues), 23.9 bits, E=5.3e-09
• PF08659: KR
  • amino acids 15 to 180 (166 residues), 54.9 bits, E=2.2e-18
• PF13561: adh_short_C2
  • amino acids 19 to 240 (222 residues), 133.3 bits, E=2.3e-42

Best Hits

Swiss-Prot: 89% identical to YCIK_ECOLI: Uncharacterized oxidoreductase YciK (yciK) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to sec:SC1714)

MetaCyc: 53% identical to CAI-1 synthase (Vibrio cholerae O1 biovar El Tor str. N16961)
1.1.1.-

Predicted SEED Role

"YciK-like oxidoreductase"

MetaCyc Pathways

• autoinducer CAI-1 biosynthesis (2/3 steps found)

Protein Sequence (253 amino acids)

>GFF2717 YciK-like oxidoreductase (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MHYQPKQDLLQNRIILVTGASDGIGREAALTYARYGATVILLGRNEEKLRRVAQHIADEQ
HVQPQWFTLDLLTCTAEECRQVADRIAAHYPRLDGVLHNAGLLGEIGPMSEQDPQIWQDV
MQVNVNATFMLTQALLPLLLKSDAGSLVFTSSSVGRQGRANWGAYATSKFATEGMMQVLA
DEYQNRSLRVNCINPGGTRTSMRASAFPTEDPQKLKTPADIMPLYLWLMGDDSRRKTGMT
FDAQPGRKPGIAQ