Protein Info for GFF2711 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF13103: TonB_2" amino acids 156 to 236 (81 residues), 34.1 bits, see alignment E=2.5e-12 PF03544: TonB_C" amino acids 169 to 242 (74 residues), 35.8 bits, see alignment E=9.2e-13 TIGR01352: TonB family C-terminal domain" amino acids 172 to 243 (72 residues), 36.7 bits, see alignment E=2e-13

Best Hits

KEGG orthology group: K03832, periplasmic protein TonB (inferred from 85% identity to xau:Xaut_2278)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (246 amino acids)

>GFF2711 hypothetical protein (Xanthobacter sp. DMC5)
MSFSLGHGLAASLALHGALILPFVVVLDEPPPRDNPLLVVELQGLLSDTQSEQQALQQNK
GAPEQQRQEEAQEEQKTQSAQAASPDRPQEDQAPDGTLAPAPPPAPEQKQEEATPQESAK
PAEAQSDTPGLANVQGAQEQKQAQTVAPVDERHILQAYVRSLTKKLKDNLVYPPDAQRSI
RRKGTTYVSFIVEADGSVRPGTLTIERSSGTPVYDAAALRTVEKNAPFDPPPRPMTVGLP
VDYFPN