Protein Info for GFF2709 in Xanthobacter sp. DMC5

Annotation: ABC transporter ATP-binding/permease protein YojI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 561 transmembrane" amino acids 24 to 45 (22 residues), see Phobius details amino acids 63 to 87 (25 residues), see Phobius details amino acids 120 to 145 (26 residues), see Phobius details amino acids 151 to 175 (25 residues), see Phobius details amino acids 243 to 263 (21 residues), see Phobius details amino acids 269 to 288 (20 residues), see Phobius details TIGR01194: cyclic peptide transporter" amino acids 19 to 549 (531 residues), 529.9 bits, see alignment E=3.8e-163 PF00664: ABC_membrane" amino acids 61 to 174 (114 residues), 33.7 bits, see alignment E=4.9e-12 PF00005: ABC_tran" amino acids 362 to 494 (133 residues), 84.9 bits, see alignment E=1.2e-27

Best Hits

Predicted SEED Role

"PvdE, pyoverdine ABC export system, fused ATPase and permease components" in subsystem Siderophore Pyoverdine

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (561 amino acids)

>GFF2709 ABC transporter ATP-binding/permease protein YojI (Xanthobacter sp. DMC5)
MKTDPPLSASAVLLHAGQLLSPLWRLLVLATVAGLCGGLATPWLLATVNLALHAPLGEEV
APIAAFGALCVLSLGGSALAGALNSIVGQRLIAALRKDISARILRAPIAKLEDYRSHRLM
AVLTTDVDTVSAFTFNMSGYAIALAVTLGSIGYLAALSPAACVLAIIFLGLGAAAKRFAQ
RRWIRDYEAVRHAQDDLHRQYRAIIEGAKELKLHQPRRALVFGARLGGAADLICRHKSRA
MTLYWVADVAGTGGVFILIGLLIAAHGALAIDSVALSGAVIVLLYVRGPIELLGSALPMF
DQARIALGRIAQLSEALADGEPGLTLAKPAAIAPPTFTNIALVAITYRFPPKQDGTPFAL
GPLDLRLERGELVFIVGANGSGKTTLVKLLLGLYAPSSGTVLKDGVAVTAERRDDYRQLF
SPIFSDYFLFDDIACDLREGAAGALLERFGLAGKVSLEGVRFSTTDLSTGQRKRLALVEA
LLERRPILITDEWAADQDPDFRRLFYEELLPELKREGRTLIVVSHDDRYFHLADRIVRMA
GGRIVEDAQAVRPRIGMENAP