Protein Info for PS417_13820 in Pseudomonas simiae WCS417

Annotation: UDP-glucose 6-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03026: nucleotide sugar dehydrogenase
  • amino acids 1 to 420 (420 residues), 443.8 bits, E=2.8e-137
• PF03721: UDPG_MGDP_dh_N
  • amino acids 1 to 186 (186 residues), 210 bits, E=4.6e-66
• PF00984: UDPG_MGDP_dh
  • amino acids 204 to 296 (93 residues), 125 bits, E=2.1e-40
• PF03720: UDPG_MGDP_dh_C
  • amino acids 320 to 423 (104 residues), 100.1 bits, E=1.7e-32

Best Hits

KEGG orthology group: K00012, UDPglucose 6-dehydrogenase [EC: 1.1.1.22] (inferred from 98% identity to pfs:PFLU3036)

Predicted SEED Role

"UDP-glucose dehydrogenase (EC 1.1.1.22)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) or Teichuronic acid biosynthesis (EC 1.1.1.22)

MetaCyc Pathways

• UDP-α-D-glucuronate biosynthesis (from UDP-glucose) (1/1 steps found)
• colanic acid building blocks biosynthesis (8/11 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-α-D-xylose biosynthesis (1/2 steps found)
• UDP-sugars interconversion (2/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism
• Nucleotide sugars metabolism
• Pentose and glucuronate interconversions
• Starch and sucrose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.22

Sequence Analysis Tools

See A0A1N7UI16 at UniProt or InterPro

Protein Sequence (459 amino acids)

>PS417_13820 UDP-glucose 6-dehydrogenase (Pseudomonas simiae WCS417)
MKISVFGSGYVGLVQATVLAEVGHDVICMDVDKNKVESLQKGHVTIFEPGLAAMVKENLE
SGRLHFTHDEKLAVEHGEVLFIAVGTPSDEDGSADLKYVLSVGDAVARHRKEPVILVEKS
TVPVGTGDTLRAHIEKALHLAGRHLEFDIVSNPEFLKEGSAVADCRRPDRIIIGCEREDV
REVMRDLYAPFNRNHDRIIFMDLRSAELTKYAANCMLATKISFINQIAELAEHLGADIEA
VRLGIGADSRIGYHFIYPGCGYGGSCFPKDMRALIHSAKQANCSSDLLEAVEAINQRQKS
KLFERINAFFKGNLRGKTFALWGLAFKPNTDDMRDAPSRVLMEALWAAGANVRAFDPEAM
QETQRIYGDDPRLMLMGTPESTLGGADALIVCTEWQQFKAPDFDLIHQRLKTPVIFDGRN
LYDGERLARKGFQYYPIGRGDSCQLPIPQQQWLPQVVEA