Protein Info for PS417_13790 in Pseudomonas simiae WCS417

Annotation: UDP phosphate 4-deoxy-4-formamido-L-arabinose transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 transmembrane" amino acids 234 to 259 (26 residues), see Phobius details amino acids 268 to 294 (27 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 9 to 147 (139 residues), 29.2 bits, see alignment E=1.4e-10 PF10111: Glyco_tranf_2_2" amino acids 10 to 102 (93 residues), 29.4 bits, see alignment E=8.6e-11 PF00535: Glycos_transf_2" amino acids 10 to 171 (162 residues), 120.8 bits, see alignment E=8.6e-39

Best Hits

Swiss-Prot: 99% identical to ARNC_PSEFS: Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K10012, undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase [EC: 2.7.8.30] (inferred from 99% identity to pfs:PFLU3042)

MetaCyc: 68% identical to undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (Escherichia coli K-12 substr. MG1655)
RXN0-3521 [EC: 2.4.2.53]

Predicted SEED Role

"Polymyxin resistance protein ArnC, glycosyl transferase (EC 2.4.-.-)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) (EC 2.4.-.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.-.-

Use Curated BLAST to search for 2.4.-.- or 2.4.2.53 or 2.7.8.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U1U2 at UniProt or InterPro

Protein Sequence (344 amino acids)

>PS417_13790 UDP phosphate 4-deoxy-4-formamido-L-arabinose transferase (Pseudomonas simiae WCS417)
MKPYPIHCVSIVIPVYNEQESLPELLRRTTAACKQLAYEYEIILVDDGSRDNSAQLLEDA
AAEDGSNVVAVILNRNYGQHAAIMAGFEQCRGDVVITLDADLQNPPEEIPRLVDQAALGY
DVVATVRNNRQDSAFRRWPSRLINLAVQRSTGVAMTDYGCMLRAYRRTIVDAMLACRERS
TFIPILANGFARHTTEILVHHAEREHGESKYSAMRLISLMFDLLTCMTTTPLRLLSIVGF
SLAALGMLFALALIVMRLAFGADWAGDGLFVLFAVLFVFTGGQFIGMGLLGEYLGRMYSD
VRARPRFFIEKVLRNQPAAPAPVVVVDGLVSSHTSTSSADQVQS