Protein Info for GFF2702 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Membrane-bound metal-dependent hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 61 to 78 (18 residues), see Phobius details amino acids 90 to 111 (22 residues), see Phobius details amino acids 123 to 147 (25 residues), see Phobius details amino acids 155 to 174 (20 residues), see Phobius details PF04307: YdjM" amino acids 1 to 177 (177 residues), 105.5 bits, see alignment E=1.2e-34

Best Hits

KEGG orthology group: K09151, hypothetical protein (inferred from 62% identity to aaa:Acav_2191)

Predicted SEED Role

"Membrane-bound metal-dependent hydrolase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (338 amino acids)

>GFF2702 Membrane-bound metal-dependent hydrolase (Hydrogenophaga sp. GW460-11-11-14-LB1)
MDSLTQIALGSAVGVAVMGRRTAVWKAALWGAIGGTLPDLDAFINHGDAVLNMTRHRAES
HALFVLTLAAPVLAWIVSRVHGEAALFKRWWLAMWLVLITHPLLDTMTVYGTQLLQPFSD
YPFAVGSVFIIDLAYTLPLIVGVIAALRLKSARGLGWNTAGLVLSTLYLAWSVGAQQHVT
QVARASLQADGIAADGLLVTPSPFNTVLWRLVATTPTEYREGFYSLLDDSPRITWTVHGR
GADLMAQHRDEPYLARMAAFTHGFYRVSAIDGHLFVTDLRMGQEPHYTFRFDLGTDAARA
QGGYRPTLEGSRPDLAQALPWLWRRIGGDRSMPAVSTP