Protein Info for GFF2701 in Sphingobium sp. HT1-2

Annotation: Cobalt/zinc/cadmium resistance protein CzcD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 transmembrane" amino acids 32 to 52 (21 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details amino acids 101 to 123 (23 residues), see Phobius details amino acids 131 to 155 (25 residues), see Phobius details amino acids 185 to 205 (21 residues), see Phobius details amino acids 211 to 231 (21 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 29 to 313 (285 residues), 212.2 bits, see alignment E=4.9e-67 PF01545: Cation_efflux" amino acids 35 to 242 (208 residues), 115.1 bits, see alignment E=1.8e-37

Best Hits

KEGG orthology group: None (inferred from 74% identity to npp:PP1Y_AT34580)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (316 amino acids)

>GFF2701 Cobalt/zinc/cadmium resistance protein CzcD (Sphingobium sp. HT1-2)
VSTKTAVLADTGHLTHEHMFLAASHDDNARRTLWVVVLTALMMVAEIVAGYTTGSMALLA
DGFHMATHAGALGVAAAAYAYAKRNAHNGDFSFGTGKVGDLAGFASALVLGIIALAIGVE
SVMRLFEPINVAFAEATWIAILGLLVNIASAFLLSGGHGHDHGHHHDHGHHHGHSHGGDN
NLRSAYMHVLADALTSVLAIAALLAGRYLGWVWMDPIMGIVGAVVIARWSWSLMRDTAAI
LLDRTDRHVADEVRELVETTGDARITDLHVWKIGPEAHSAIVGVSAHPGVDATEIRRRLV
PVHELQHLTVEVATVA