Protein Info for GFF27 in Variovorax sp. SCN45

Annotation: 4-hydroxybenzoyl-CoA thioesterase family active site

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 TIGR00051: acyl-CoA thioester hydrolase, YbgC/YbaW family" amino acids 16 to 127 (112 residues), 84.7 bits, see alignment E=3.1e-28 PF13279: 4HBT_2" amino acids 19 to 137 (119 residues), 41.1 bits, see alignment E=5.8e-14 PF03061: 4HBT" amino acids 28 to 109 (82 residues), 46.8 bits, see alignment E=7.5e-16 PF13673: Acetyltransf_10" amino acids 171 to 290 (120 residues), 62.7 bits, see alignment E=8.7e-21 PF00583: Acetyltransf_1" amino acids 179 to 269 (91 residues), 46.9 bits, see alignment E=8.2e-16 PF13508: Acetyltransf_7" amino acids 193 to 270 (78 residues), 40.2 bits, see alignment E=9.1e-14

Best Hits

KEGG orthology group: None (inferred from 86% identity to vpe:Varpa_3107)

Predicted SEED Role

"4-hydroxybenzoyl-CoA thioesterase family active site" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (291 amino acids)

>GFF27 4-hydroxybenzoyl-CoA thioesterase family active site (Variovorax sp. SCN45)
MSETATHRKNFRFFHRLRVRWAEVDMQKIVFNAHYLMYFDTAISDYWRALALPYEESMHS
LAGDLYVRKATIDFRASARMDDMLDVGMRCARIGNSSMVFEGGLFRQDQFLVGCELVYVF
ADPATQTSKPVPEKLRSLLAGYEAGEPMRTVETGDWATLGESAGALRRAVFVEEQNIPES
LEWDEHDAKVLHAVARNRLGQVIATGRLLHAEDGVSHIGRMAVHRNLRSGGHGAAVMQAL
EEAARARGDRVVALNAQRSAERFYARLGYVSHGDGFEEAGIPHIEMRRTLG