Protein Info for GFF2698 in Xanthobacter sp. DMC5

Annotation: Sensor histidine kinase RcsC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 687 PF08447: PAS_3" amino acids 177 to 259 (83 residues), 43.3 bits, see alignment E=7.1e-15 TIGR00229: PAS domain S-box protein" amino acids 199 to 273 (75 residues), 24.3 bits, see alignment E=1.4e-09 PF00512: HisKA" amino acids 322 to 384 (63 residues), 37 bits, see alignment E=5.7e-13 PF02518: HATPase_c" amino acids 428 to 544 (117 residues), 73.5 bits, see alignment E=3.7e-24 PF00072: Response_reg" amino acids 567 to 649 (83 residues), 55.2 bits, see alignment E=1.5e-18

Best Hits

KEGG orthology group: None (inferred from 56% identity to rec:RHECIAT_CH0002504)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (687 amino acids)

>GFF2698 Sensor histidine kinase RcsC (Xanthobacter sp. DMC5)
MAISNSPSRALVLAPYGRDGAIACELLASAKINSVICKDLLELESQLGEDASLAVVDEDA
LRHGYLQGVKARLAAQPSWSDIPFIILTRRAPALDQGRESMLLHDIISNVTLLERPFHPT
TFVSVARTALKGRQRQYEARARMEQLHEGEERLRTALLAGRLGAFELNFQNWTLMTSATC
RTLLGRAVDEPFAFDDLLQAIHADDRSNVLAAIDGAARSGGDLVEEFRVPWRDGSTHCVE
IRARAVRDRSAANPRLVGVLSDVTDRKARQDALTRMNEILEERVAARTAELTASHAAVLA
EMEQRKRAEEQLRQVQKMETIGQLTGNVAHDFNNLLTAVIGNLELLRKRVANDPRAVRLV
DGACQGAQRGAALTQRLLAFARRQDLKVEPRSLTDLVSGAVDLIERSIGSRIELRLHLSQ
DSPPALVDANQIELALLNLVVNARDAMPNGGVVSISVDHPQAAPGAGLPEGPYVRLTVSD
TGYGMDAETLEKATEPFFSTKEQGKGTGLGLSMVHGLAVQLNGALRLSSEVGAGTRAELW
LPATTPLVGEEKRAPISVGREMEELNVLVVDDDFLVAFSTVEMLRDLGHRVVESSSGEDA
LEIIRNDSTVDIMVTDFSMPRMNGAQLASAARRLRPDLPILLASGYAELPSDSIRDLPRI
AKPYQQEQLAAEIVKVWKRATGRDQAL