Protein Info for GFF2697 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Cardiolipin synthetase (EC 2.7.8.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 507 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF13091: PLDc_2" amino acids 80 to 202 (123 residues), 43.2 bits, see alignment E=3.5e-15 amino acids 316 to 451 (136 residues), 78 bits, see alignment E=5.8e-26 PF00614: PLDc" amino acids 401 to 425 (25 residues), 24.5 bits, see alignment (E = 2.2e-09)

Best Hits

KEGG orthology group: None (inferred from 60% identity to axy:AXYL_05313)

Predicted SEED Role

"Cardiolipin synthetase (EC 2.7.8.-)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (507 amino acids)

>GFF2697 Cardiolipin synthetase (EC 2.7.8.-) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSFFKPGVWAMALLTALLTGCALPPLDGRTETQALPPTEAAATALGRALSAQVLGHPGES
GILPLADALESFAARVLLVRAAERTLDVQYYIWRDDLTGNLLLNALREAADRGVRVRLLL
DDNGVAMDAKLLALDRHPGIEVRLFNPFSIRQPKALGYLTHFSRANRRMHNKALIADSQA
AIVGGRNVGDEYFGATDGVLFADLDVLAMGAVLPELSTDFDRYWASASAYPIDRIVVREA
AAQDAAAQPERDPRAARYLEALRQSRFVSDVLSGGLVPQWARVEMVSDDPRKGLGQAEKE
GLVTHQLAQVLARPPRRSLDLVSPYFVPTAAGVEVFERLAASGVRVRILTNALEATDVSA
VHSGYARYRKALLRSGVELHEMRRGAVVMGRSGVLGSSGSSLHAKTFAVDGERVFVGSMN
FDPRSAHLNTELGFIIDSPAMAQAVGQVFDSEVPAAAFAVRLDEHGDLVWIERREGQSIL
HPHEPGATFGRRAWIGLLSVLPIEWLL