Protein Info for PS417_13745 in Pseudomonas simiae WCS417

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF06884: DUF1264
  • amino acids 58 to 222 (165 residues), 243.5 bits, E=4.8e-77

Best Hits

Swiss-Prot: 42% identical to OBP2A_MAIZE: Oil body-associated protein 2A (OBAP2A) from Zea mays

KEGG orthology group: None (inferred from 76% identity to pfv:Psefu_3444)

Predicted SEED Role

"Glycerate kinase (EC 2.7.1.31)" in subsystem Allantoin Utilization or D-galactarate, D-glucarate and D-glycerate catabolism or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Glycine and Serine Utilization or Photorespiration (oxidative C2 cycle) or Serine-glyoxylate cycle (EC 2.7.1.31)

MetaCyc Pathways

• photorespiration I (5/9 steps found)
• photorespiration III (5/9 steps found)

KEGG Metabolic Maps

• Glycerolipid metabolism
• Glycine, serine and threonine metabolism
• Glyoxylate and dicarboxylate metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.31

Use Curated BLAST to search for 2.7.1.31

Sequence Analysis Tools

See A0A1N7UFI0 at UniProt or InterPro

Protein Sequence (252 amino acids)

>PS417_13745 hypothetical protein (Pseudomonas simiae WCS417)
MTNTPSMAKSFSLAATFTLLSACAGNDSPSNVGAPGKPATPSTRTLEAGAALLQSRPPVD
ALNAYLDGFHFYNGHPEVQMEAHHYCAVLNEEVIQCVIYDGNRKDAKLMGVEYIISEQLF
NTLPAPEKALWHSHVHEVKSGQLVAPGIPEVAEHALMEKLVHTYGKTWHTWHTDLDKRLP
LGVPQLMMGFTADGQADPRMVSQRDQRMGIDSAEKKKTRVDIVAPPIAPGADAWQQGNVI
QITDPAVAPHHH