Protein Info for GFF2692 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Peptide transport system ATP-binding protein SapF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 30 to 179 (150 residues), 122.3 bits, E=1.2e-39

Best Hits

Swiss-Prot: 100% identical to SAPF_SALTY: Peptide transport system ATP-binding protein SapF (sapF) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02032, peptide/nickel transport system ATP-binding protein (inferred from 98% identity to ecr:ECIAI1_1315)

MetaCyc: 98% identical to putrescine ABC exporter ATP binding protein SapF (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-328 [EC: 7.6.2.16]

Predicted SEED Role

"Peptide transport system ATP-binding protein SapF"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.16

Protein Sequence (268 amino acids)

>GFF2692 Peptide transport system ATP-binding protein SapF (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MVETLLEVRNLSKTFRYRTGWFRRQTVDAVKPLSFTLRERQTLAIIGENGSGKSTLAKML
AGMIEPTSGELLIDDHPLHYGDYSFRSQRIRMIFQDPSTSLNPRQRISQILDFPLRLNTD
LEPEQRRKQIVETMRMVGLLPDHVSYYPHMLAPGQKQRLGLARALILRPKVIIADEALAS
LDMSMRSQLINLMLELQEKQGISYIYVTQHIGMMKHISDQVLVMHQGEVVERGSTADVLA
SPLHELTRRLIAGHFGEALTADAWRKDR