Protein Info for GFF2690 in Sphingobium sp. HT1-2

Annotation: CzcABC family efflux RND transporter, membrane fusion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF16576: HlyD_D23" amino acids 74 to 285 (212 residues), 74.2 bits, see alignment E=9.7e-25 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 80 to 375 (296 residues), 149.4 bits, see alignment E=6.1e-48 PF13437: HlyD_3" amino acids 199 to 297 (99 residues), 63.1 bits, see alignment E=3.9e-21

Best Hits

Swiss-Prot: 43% identical to NCCB_ALCXX: Nickel-cobalt-cadmium resistance protein NccB (nccB) from Alcaligenes xylosoxydans xylosoxydans

KEGG orthology group: None (inferred from 53% identity to pzu:PHZ_p0239)

Predicted SEED Role

"Cobalt/zinc/cadmium efflux RND transporter, membrane fusion protein, CzcB family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (384 amino acids)

>GFF2690 CzcABC family efflux RND transporter, membrane fusion protein (Sphingobium sp. HT1-2)
MKSDNTLYAGAAVGLILAALAGFGVARMTAPSAPVAEESAAEAEAQPADTLEITADGIKT
SAISVEAVSGSSLSGIVMASATVEATPDAEAVLTARAPGTVTRIFKRIGDTVQAGEAIAL
VESRDASAIAADRGTAAARATLAARQLAREKSLLAQGVSARADYETAEANLAVARAEARQ
ADAAARAARVAGDGRSVSVVSSVSGRITSATASLGSFVQAETELFRVADPRSIQIEAAVP
VADAGRVKAGDRVELTTSDGQKVEGRVRSATGVVDAQTRQATVVITPSGGGSAIAPGQLV
QARIFASGGQGASGVTVPQDAVQTVGERTVVFVRTPKGFKAQTVQVASRSGGMVAIAVGL
KAGQQIATTNAFLLKAELEKESAE