Protein Info for GFF269 in Xanthobacter sp. DMC5

Annotation: Acetyl-CoA:oxalate CoA-transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02515: CoA_transf_3
  • amino acids 5 to 378 (374 residues), 444.2 bits, E=2e-137

Best Hits

Swiss-Prot: 39% identical to MCT_HALMA: Succinyl-CoA:mesaconate CoA-transferase (mct) from Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)

KEGG orthology group: None (inferred from 92% identity to xau:Xaut_4713)

MetaCyc: 59% identical to succinyl-CoA-glutarate CoA-transferase (Pseudomonas putida)
Succinate--hydroxymethylglutarate CoA-transferase. [EC: 2.8.3.13]

Predicted SEED Role

No annotation

MetaCyc Pathways

• L-lysine degradation X (4/6 steps found)
• L-lysine degradation IV (2/5 steps found)
• superpathway of L-lysine degradation (13/43 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.3.13

Protein Sequence (391 amino acids)

>GFF269 Acetyl-CoA:oxalate CoA-transferase (Xanthobacter sp. DMC5)
MSPPLAGLRVLELARILAGPWCGQLLADLGAEVIKVERPGGGDDTRTWGPPFLKGADGAD
LGAAYFHSTNRGKRSVAVDFETEEGQKIIRDLARQSDVLIENFKVGGLKKYGLDYESLRK
ENPRLVYCSVTGFGQDGPYAPRAGYDFLVQGMGGIMDLTGAPDGEPQKVGVAFADIFTGL
YATVGILAALRRRDETGTGGHVDMALLDTQVGVLANQAMNYITSGKAPKRMGNAHPNIVP
YQVFPCADGYFIAAIGNDGQFARFCAVLGAPELAHQDDYATNPARVANRAVLVPKLTALT
MTFARDDLLAALEAKGVPAGPINTVSQVFEDPQVKARGLRVDLAEAGGGTIPAVASPIVL
DGERQVAKSASPRLGADTEAVLAALKALAGN