Protein Info for GFF2687 in Sphingobium sp. HT1-2

Annotation: putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 transmembrane" amino acids 41 to 59 (19 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details amino acids 91 to 108 (18 residues), see Phobius details amino acids 125 to 142 (18 residues), see Phobius details amino acids 156 to 180 (25 residues), see Phobius details amino acids 192 to 214 (23 residues), see Phobius details PF13795: HupE_UreJ_2" amino acids 18 to 212 (195 residues), 229.3 bits, see alignment E=1.5e-72

Best Hits

KEGG orthology group: None (inferred from 74% identity to pzu:PHZ_c1448)

Predicted SEED Role

"putative ORF1 [Plasmid pTOM9]"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (219 amino acids)

>GFF2687 putative membrane protein (Sphingobium sp. HT1-2)
LAFFVVDVALAHGVAEGDKGYIEETTGPQIGAFLYLGAKHMVTGYDHLLFLFGVIFFLYR
MREVASYVTLFAIGHSTTLIAGVLLGTNVSAYLVDAIIGLSVVYKALDNLGAFQRWFGFQ
PNTKAAVLIFGFFHGFGLATKLQDFALSSDGLITNLIAFNVGVEMGQILALSAILIIMGY
WRRTRSFAKHAFTANVVLMTAGFVLTGYQLAGLYLGDPS