Protein Info for PS417_13705 in Pseudomonas simiae WCS417
Annotation: oxaloacetate decarboxylase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 98% identical to OADC_PSEFS: Oxaloacetate decarboxylase (PFLU_3105) from Pseudomonas fluorescens (strain SBW25)
KEGG orthology group: None (inferred from 98% identity to pfs:PFLU3105)MetaCyc: 76% identical to oxaloacetate decarboxylase monomer (Pseudomonas aeruginosa)
Malate dehydrogenase (oxaloacetate-decarboxylating). [EC: 1.1.1.38, 1.1.1.40, 1.1.1.83, 4.1.1.112]
Predicted SEED Role
"Carboxyphosphonoenolpyruvate phosphonomutase"
MetaCyc Pathways
- superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
- superpathway of glyoxylate bypass and TCA (11/12 steps found)
- superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
- TCA cycle I (prokaryotic) (9/10 steps found)
- gluconeogenesis I (11/13 steps found)
- superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
- TCA cycle VIII (Chlamydia) (5/6 steps found)
- glyoxylate cycle (5/6 steps found)
- TCA cycle II (plants and fungi) (7/9 steps found)
- TCA cycle V (2-oxoglutarate synthase) (7/9 steps found)
- mixed acid fermentation (12/16 steps found)
- TCA cycle III (animals) (7/10 steps found)
- malate/L-aspartate shuttle pathway (1/2 steps found)
- TCA cycle IV (2-oxoglutarate decarboxylase) (6/9 steps found)
- gluconeogenesis III (8/12 steps found)
- chitin deacetylation (2/4 steps found)
- C4 photosynthetic carbon assimilation cycle, NADP-ME type (4/7 steps found)
- anaerobic energy metabolism (invertebrates, cytosol) (4/7 steps found)
- C4 photosynthetic carbon assimilation cycle, PEPCK type (9/14 steps found)
- L-carnitine degradation II (1/3 steps found)
- C4 photosynthetic carbon assimilation cycle, NAD-ME type (6/11 steps found)
- reductive TCA cycle I (6/11 steps found)
- incomplete reductive TCA cycle (3/7 steps found)
- anaerobic energy metabolism (invertebrates, mitochondrial) (5/10 steps found)
- methylgallate degradation (2/6 steps found)
- protocatechuate degradation I (meta-cleavage pathway) (3/8 steps found)
- pyruvate fermentation to propanoate I (2/7 steps found)
- superpathway of anaerobic energy metabolism (invertebrates) (9/17 steps found)
- formaldehyde assimilation I (serine pathway) (6/13 steps found)
- reductive TCA cycle II (5/12 steps found)
- methylaspartate cycle (10/19 steps found)
- superpathway of vanillin and vanillate degradation (3/10 steps found)
- (S)-lactate fermentation to propanoate, acetate and hydrogen (5/13 steps found)
- syringate degradation (3/12 steps found)
- L-glutamate degradation VIII (to propanoate) (2/11 steps found)
- Methanobacterium thermoautotrophicum biosynthetic metabolism (20/56 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of terpenoids and steroids
- Butanoate metabolism
- Carbon fixation in photosynthetic organisms
- Pyruvate metabolism
Isozymes
Compare fitness of predicted isozymes for: 1.1.1.40
Use Curated BLAST to search for 1.1.1.38 or 1.1.1.40 or 1.1.1.83 or 4.1.1.112
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1N7TXN3 at UniProt or InterPro
Protein Sequence (289 amino acids)
>PS417_13705 oxaloacetate decarboxylase (Pseudomonas simiae WCS417) MPKISHSALRRKFRELLATPTCVETASVFDPMSARIAADLGFEVGILGGSVASLQVLAAP DFALITLSEFVEQATRIGRVAQLPFIADADHGYGNALNVMRTVEELERAGVAALTIEDTL LPAQFGRKSTDLISIEEGIGKVRAALEARVDPQLSIIARTNAGVLPTEAVIERTLAYQQA GADGICMVGVADFEHLEKIAENLTVPLMLVTYGNPKLNDAKRLASLGVRVVVAGHGAYFA AIKATYDSLRAQRQLTHSTDNLSATELTHTYTLPESYVAWAEEFMDVKE