Protein Info for PS417_13680 in Pseudomonas simiae WCS417

Annotation: 3-oxoacyl-ACP synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF00109: ketoacyl-synt" amino acids 3 to 256 (254 residues), 202.3 bits, see alignment E=1e-63 TIGR03150: beta-ketoacyl-acyl-carrier-protein synthase II" amino acids 3 to 419 (417 residues), 557.1 bits, see alignment E=9.9e-172 PF02801: Ketoacyl-synt_C" amino acids 265 to 377 (113 residues), 124 bits, see alignment E=3.4e-40

Best Hits

Swiss-Prot: 56% identical to FABF_RHIME: 3-oxoacyl-[acyl-carrier-protein] synthase 2 (fabF) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K09458, 3-oxoacyl-[acyl-carrier-protein] synthase II [EC: 2.3.1.179] (inferred from 94% identity to pfs:PFLU3108)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier-protein] synthase, KASII (EC 2.3.1.179)" (EC 2.3.1.179)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.179

Use Curated BLAST to search for 2.3.1.179

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U6R3 at UniProt or InterPro

Protein Sequence (422 amino acids)

>PS417_13680 3-oxoacyl-ACP synthase (Pseudomonas simiae WCS417)
MNKRIVVTGMGALTPLGADVESTWQRLLAGQSGIRRLPEELVGDLAVSIGGQVQSVQQDP
EAGFDPDRLLAPKEQRKMDRFILFALAAADEALKQAGWAPVTPEAQERTATIIASGVGGF
PAIADAVRTTDSKGPRRLSPFTIPSFLSNMAAGHVSINYGLKGPLGAPVTACAAGVQAIG
DAARMIRAGEVDVAVCGGAEAAIHRVSLAGFAAARALSSDFNETPELASRPFDQARDGFV
MGEGAGILVIEELEHALARGAQPIAELVGYGTSADAYHMTAGPEDGDGARRAMLQALRQA
GIDATQVQYLNAHATSTPVGDKGELAAINTVFGAKGSPAISSTKSATGHLLGAAGGIEAI
FTVLALRDQVAPVTLNLQNPDPLADGLDMVRGAARPMPIEYALSNGFGFGGVNASVLFRR
WA