Protein Info for PS417_13665 in Pseudomonas simiae WCS417

Annotation: multidrug DMT transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 37 to 58 (22 residues), see Phobius details amino acids 68 to 86 (19 residues), see Phobius details amino acids 92 to 116 (25 residues), see Phobius details amino acids 125 to 143 (19 residues), see Phobius details amino acids 151 to 172 (22 residues), see Phobius details amino acids 182 to 202 (21 residues), see Phobius details amino acids 210 to 231 (22 residues), see Phobius details amino acids 239 to 260 (22 residues), see Phobius details amino acids 266 to 283 (18 residues), see Phobius details PF00892: EamA" amino acids 12 to 139 (128 residues), 44 bits, see alignment E=1.4e-15 amino acids 153 to 280 (128 residues), 65.2 bits, see alignment E=4e-22

Best Hits

KEGG orthology group: None (inferred from 94% identity to pfs:PFLU3111)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UHY9 at UniProt or InterPro

Protein Sequence (300 amino acids)

>PS417_13665 multidrug DMT transporter permease (Pseudomonas simiae WCS417)
MDTSIRRGSWEMIAAMLISGTIGWFVLVSGVSVIEVVFWRCVIGGLTLLLVCALLGYLRL
DLLNGAKLGLAMLSGVAIVGNWLLLFESYSRASIAISTAVYNVQPFMLVMLAAVFLGEKI
TVQKLAWLSIAFLGMLAIVTAHGDQQTGDDYLAGIALALGAAFLYAIAALIIKRLKEVPP
HLMALIQVTTGALLLAPMVPWNSLPATTNAWAALVTLGVVHTGLMYVLLYGAIQKLPTAI
TGALSFIYPIAAIFVDWIAFGHRLGWLQWLGVAAILLAAAGLQRGWWWPRSQTVSAYPGK