Protein Info for GFF2676 in Xanthobacter sp. DMC5

Annotation: tRNA U34 carboxymethyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 TIGR04290: methyltransferase, Rta_06860 family" amino acids 7 to 232 (226 residues), 383.7 bits, see alignment E=1.3e-119 PF08003: Methyltransf_9" amino acids 41 to 148 (108 residues), 59.7 bits, see alignment E=7.3e-20 PF13489: Methyltransf_23" amino acids 47 to 190 (144 residues), 47 bits, see alignment E=7.2e-16 PF13847: Methyltransf_31" amino acids 56 to 146 (91 residues), 44.8 bits, see alignment E=3.1e-15 PF13649: Methyltransf_25" amino acids 59 to 137 (79 residues), 50.8 bits, see alignment E=6.6e-17 PF08241: Methyltransf_11" amino acids 60 to 144 (85 residues), 40 bits, see alignment E=1.5e-13 PF08242: Methyltransf_12" amino acids 60 to 148 (89 residues), 31.9 bits, see alignment E=5.5e-11

Best Hits

KEGG orthology group: K15257, tRNA (mo5U34)-methyltransferase [EC: 2.1.1.-] (inferred from 72% identity to bra:BRADO2072)

Predicted SEED Role

"Methyltransferase type 11"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (252 amino acids)

>GFF2676 tRNA U34 carboxymethyltransferase (Xanthobacter sp. DMC5)
MKLSEDQIRQRVAALGPWFHNLDLSGVPTAPDHFLGDYPRVKWRRFADAIPSDLTGLSVL
DIGCNGGFYSIEMKRRGAARVVGIDSDEAYLAQARFAAEVAGLEITFEKRSVYDVARVGE
RFDIVLFMGVLYHLRHPLLALDLIRTHVAGDLLVFQSMLRGSRDVEDQLEDSDFWTTAPF
DKGSYPRLHFIEHRYAGDPTNWWVPNRACVEAMLRSSGFEIVGHPEEEVYLCRAAGPPGG
EGAVYPGWGGGT