Protein Info for PS417_13645 in Pseudomonas simiae WCS417
Annotation: ABC transporter
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K10439, ribose transport system substrate-binding protein (inferred from 96% identity to pfs:PFLU3117)Predicted SEED Role
"Xylose ABC transporter, periplasmic xylose-binding protein XylF" in subsystem Xylose utilization
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1N7UL37 at UniProt or InterPro
Protein Sequence (310 amino acids)
>PS417_13645 ABC transporter (Pseudomonas simiae WCS417) MNLKRMFPVIALAALMSQAVEARELKALGISMGSLGNPYFVTLADGATARAKELNPNVKV TSVSADYDLSKQFSQIDNFISSKVDLILINAVDPSAMASAIKKARDAGIVVVAVDVDAKG VNATVQTDNVEAGKLACQYLVDKLSGKGNVIIQNGPQVTAVTDRVKGCKAALAAAPDIKV LSDDQDGKGSREGGLNVMQGYLTRFPKIDGLFAINDPQAVGSDLAAKQLKRSGLIITSVD GAPDIENALKTDSQIQASSSQDPWAMAQTAVNVGNDILNDKAPAEAVTLLTPKLITRDNI GTYSGWSSKH