Protein Info for GFF2674 in Xanthobacter sp. DMC5

Annotation: Inositol-3-phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 transmembrane" amino acids 147 to 166 (20 residues), see Phobius details PF01658: Inos-1-P_synth" amino acids 193 to 301 (109 residues), 116.5 bits, see alignment E=3.3e-38

Best Hits

Swiss-Prot: 62% identical to INO1_MYCTO: Inositol-3-phosphate synthase (ino1) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K01858, myo-inositol-1-phosphate synthase [EC: 5.5.1.4] (inferred from 72% identity to mex:Mext_0503)

MetaCyc: 62% identical to inositol-1-phosphate synthase subunit (Mycobacterium tuberculosis H37Rv)
Inositol-3-phosphate synthase. [EC: 5.5.1.4]

Predicted SEED Role

"Inositol-1-phosphate synthase (EC 5.5.1.4)" in subsystem Di-Inositol-Phosphate biosynthesis (EC 5.5.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.5.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (369 amino acids)

>GFF2674 Inositol-3-phosphate synthase (Xanthobacter sp. DMC5)
LGATRLRVAIVGVGNCASSLVQGLSFYRDASDGALVPGLMTPVLAGYRVRDVEISAAFDV
AAGKVGRDVAEAIHAPPNNTTIFAQVAPTGVRVARGPTLDGIGRYLAAEVEESADPVCDV
ATVLRETRTDVLVCYLPVGSQRAAEFYMEAALVAGCGVVNCLPVFIASRPEWRARFEARG
LPIIGDDIKSQVGATIVHRMLANLFAERGVKLERTYQLNVGGNADFQNMLERERLTSKKI
SKTQAVTSQMAVPLPAGDVHVGPSDFVPWLTDRKLAFIRLEGTAFGGVPLSAEVKLEVWD
SPNSAGIVIDAVRCVKLAMDRGQKGALIGPSSYFMKSPPVQFTDAEARERTLRFIAGEVE
AEGPVRLPA