Protein Info for PS417_13640 in Pseudomonas simiae WCS417

Annotation: ribose ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 59 to 90 (32 residues), see Phobius details amino acids 99 to 123 (25 residues), see Phobius details amino acids 129 to 147 (19 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 217 to 241 (25 residues), see Phobius details amino acids 256 to 287 (32 residues), see Phobius details amino acids 299 to 316 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 50 to 312 (263 residues), 139.7 bits, see alignment E=5.1e-45

Best Hits

Swiss-Prot: 32% identical to Y4MJ_SINFN: Probable ABC transporter permease protein y4mJ (NGR_a02490) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 98% identity to pfs:PFLU3118)

Predicted SEED Role

"Xylose ABC transporter, permease protein XylH" in subsystem Xylose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UFG1 at UniProt or InterPro

Protein Sequence (325 amino acids)

>PS417_13640 ribose ABC transporter permease (Pseudomonas simiae WCS417)
MAELNIATTNKAERARELMRTVGMLPVLILLLVGFALASENFLTMQNLSIISQQASVNVV
LAAGMTFVILTAGIDLSVGAILAASAVVALQASMSPQFGMFGIAAGIGFGLLLGLVNGGL
IAFMRLPPFIVTLGALTAMRGLARLLADDKTVFNPDLPFAFIGNDSLLGVPWLVIIAVAV
VALSWFILRRTVMGVQIYSVGGNPEAARLSGIKVWKVLLFVYAMSGALAGLGAVMSASRL
FAANGLQLGQSYELDAIAAVILGGTSFTGGVGTIGGTLIGALIIAVLTNGLVLLGVSDIW
QYIIKGIVIIGAVALDRYRQSGART