Protein Info for GFF2671 in Variovorax sp. SCN45

Annotation: Domain of unknown function / Efflux ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 188 to 207 (20 residues), see Phobius details amino acids 234 to 256 (23 residues), see Phobius details amino acids 268 to 295 (28 residues), see Phobius details amino acids 305 to 325 (21 residues), see Phobius details amino acids 362 to 380 (19 residues), see Phobius details PF12679: ABC2_membrane_2" amino acids 4 to 383 (380 residues), 37.6 bits, see alignment E=2.3e-13 PF12698: ABC2_membrane_3" amino acids 23 to 377 (355 residues), 99 bits, see alignment E=4.6e-32 PF01061: ABC2_membrane" amino acids 166 to 349 (184 residues), 76.7 bits, see alignment E=2.8e-25

Best Hits

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 90% identity to vpe:Varpa_2235)

Predicted SEED Role

"ABC transporter, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (385 amino acids)

>GFF2671 Domain of unknown function / Efflux ABC transporter, permease protein (Variovorax sp. SCN45)
MLLALIRKELLALVRDMHGLAALFVMPMVFIVLMSLTLKDIYRPPLAELTYAIDMRDTAT
PAQWLKQLWQRNHGAPQPLGDDWQARLRNGSLKYVIVMEQGLSEELESAALSTQARVHLL
TEPGIDANLFNALRAELVGASGELKARLALAVPGTAGPAPDASIQAMVRAERFSTAGPRP
TSVQQNVPAWLVFGMFFVVASLSSLFVQERSSGALGRLQSLGVSRFTLLASKALPYLGVN
ALQAVLMIAAGIWFMPLIGGDALSLAGIHWGALLLSLAAVSLAAVSLSLALACLVRSHAQ
AATIGPMVNVLMAAAGGIMVPKFVMPGFMQRLVEISPMNWGLEALLTVLLRGGGVADALP
QIGRLVVFAALMFFIAVFLFRRRAP