Protein Info for GFF2671 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Uncharacterized oxidoreductase YjgI (EC 1.-.-.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF00106: adh_short" amino acids 7 to 187 (181 residues), 159 bits, see alignment E=1.6e-50 PF01370: Epimerase" amino acids 9 to 172 (164 residues), 29.4 bits, see alignment E=8.4e-11 PF13561: adh_short_C2" amino acids 16 to 233 (218 residues), 177.2 bits, see alignment E=6.4e-56

Best Hits

Swiss-Prot: 80% identical to BDCA_ECOLI: Cyclic-di-GMP-binding biofilm dispersal mediator protein (bdcA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to sec:SC1669)

Predicted SEED Role

"Uncharacterized oxidoreductase YjgI (EC 1.-.-.-)" (EC 1.-.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (237 amino acids)

>GFF2671 Uncharacterized oxidoreductase YjgI (EC 1.-.-.-) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MTLFRNKSVLVLGGSRGIGAAIVRRFSADGASVVFSYAGSREAAEKLATETGSIAIQTDS
ADRDAVISLVREYGPLDILVVNAGVALFGDALEQDSDAIDRLFRINIHAPYHASVEAARN
MPEGGRIIIIGSVNGDRMPVPGMAAYAASKSALQGLARGLARDFGPRGITINVVQPGPID
TDINPEDGPMKELMHSFMAIKRHGRPEEVAGMVAWLAGPEASFVTGAMHTIDGAFGA