Protein Info for PS417_13615 in Pseudomonas simiae WCS417

Annotation: long-chain acyl-CoA synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00501: AMP-binding
  • amino acids 15 to 339 (325 residues), 156.2 bits, E=5.8e-50

Best Hits

KEGG orthology group: None (inferred from 89% identity to pfs:PFLU3122)

Predicted SEED Role

"O-succinylbenzoic acid--CoA ligase (EC 6.2.1.26)" in subsystem Menaquinone and Phylloquinone Biosynthesis (EC 6.2.1.26)

MetaCyc Pathways

• superpathway of chorismate metabolism (44/59 steps found)
• 2-carboxy-1,4-naphthoquinol biosynthesis (3/7 steps found)
• superpathway of menaquinol-8 biosynthesis I (5/10 steps found)
• superpathway of demethylmenaquinol-8 biosynthesis I (4/9 steps found)
• superpathway of menaquinol-10 biosynthesis (4/10 steps found)
• superpathway of menaquinol-11 biosynthesis (4/10 steps found)
• superpathway of menaquinol-12 biosynthesis (4/10 steps found)
• superpathway of menaquinol-13 biosynthesis (4/10 steps found)
• superpathway of menaquinol-6 biosynthesis (4/10 steps found)
• superpathway of menaquinol-7 biosynthesis (4/10 steps found)
• superpathway of menaquinol-9 biosynthesis (4/10 steps found)
• superpathway of demethylmenaquinol-6 biosynthesis I (3/9 steps found)
• superpathway of demethylmenaquinol-9 biosynthesis (3/9 steps found)
• superpathway of phylloquinol biosynthesis (4/15 steps found)

KEGG Metabolic Maps

• Ubiquinone and menaquinone biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.2.1.26

Sequence Analysis Tools

See A0A1N7U9Q7 at UniProt or InterPro

Protein Sequence (492 amino acids)

>PS417_13615 long-chain acyl-CoA synthetase (Pseudomonas simiae WCS417)
MSPETRRFHAVLRGHAERNDGAIALWGDTWKMDYTSLFAEVAYRQERLRDEGVKVVALAL
DNGVDAMLWDLAVLFEGLTCLTLPPFFSPAQRAHCLEQSHAERVIAEPHLAAELQAGGYR
QAGEFWCRTFEGRPAMPSNTAKLTFTSGTTGAPKGVCLSADSLLRVTRELHQASHSRDPR
HHLALLPIAILLENLGCYAALYAGATLSLPSQKSLGIQGASAVDAAQLLGCLATRQPHSL
ILVPQLLLMLVIAAEQKAFNPKSLRFAAVGGARVSKALLQRAQQLGMTVYEGYGLSECAS
VVCLNHPEAHRPGSVGRPLPHVEIRLAEDGEVLVKGPMLLGYLDQPDLHAPWWPTGDLGD
VDEDGFLYLKGRKKHQFVTSYGRNVNPDWVEAELTQGGIIAQAFVYGEALPENHALLWPL
RADCSAAQLAAAVAEANTGLPDYAQVHRWTRLAEPFTTANGLLTANGRPKRDAIVARYQS
DLTPELNEESSS