Protein Info for GFF2667 in Sphingobium sp. HT1-2

Annotation: Putative preQ0 transporter YhhQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 48 to 69 (22 residues), see Phobius details amino acids 81 to 102 (22 residues), see Phobius details amino acids 122 to 143 (22 residues), see Phobius details amino acids 155 to 177 (23 residues), see Phobius details amino acids 196 to 214 (19 residues), see Phobius details TIGR00697: conserved hypothetical integral membrane protein" amino acids 26 to 219 (194 residues), 117.7 bits, see alignment E=2.9e-38 PF02592: Vut_1" amino acids 54 to 213 (160 residues), 188.1 bits, see alignment E=6.4e-60

Best Hits

KEGG orthology group: K09125, hypothetical protein (inferred from 87% identity to sjp:SJA_C1-24570)

Predicted SEED Role

"Putative preQ0 transporter" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (240 amino acids)

>GFF2667 Putative preQ0 transporter YhhQ (Sphingobium sp. HT1-2)
MSDAGIRKIDATVLGARPLRYYDFFMAAFVAILLLSNLIGAAKLSSLGGVTFGAGILFFP
LGYVIGDVLTEVYGYARARRCVWAGFAAMLFMALMSWVVVALPPAEGWPDQKAYEAVFGS
TWRIVFASLCAFWAGELANSFVLAKMKIITQGRHLWMRTIGSTVVGQGVDSLLFYPLAFY
GDWTTTQVLTVMVTNWAMKVGWEAVLTPVTYVVVNGLKRREGLDVYDAGTDFTPFRTRLQ