Protein Info for GFF2666 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 TIGR00229: PAS domain S-box protein" amino acids 33 to 153 (121 residues), 79.6 bits, see alignment E=2.3e-26 PF13188: PAS_8" amino acids 35 to 88 (54 residues), 28.8 bits, see alignment 2.2e-10 PF00989: PAS" amino acids 36 to 146 (111 residues), 35.9 bits, see alignment E=1.7e-12 PF13426: PAS_9" amino acids 46 to 149 (104 residues), 38.5 bits, see alignment E=2.9e-13 PF08447: PAS_3" amino acids 58 to 143 (86 residues), 42.1 bits, see alignment E=2.2e-14 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 156 to 310 (155 residues), 109.1 bits, see alignment E=2e-35 PF00990: GGDEF" amino acids 157 to 307 (151 residues), 122.7 bits, see alignment E=3.2e-39

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (314 amino acids)

>GFF2666 hypothetical protein (Sphingobium sp. HT1-2)
MTPDAICRIDRLTHVARALSQEAQTIQANLANAERRFQATFQHAPVGIAHVALDGSFLTV
NPRFEEITGYPAAMLMRLGFQQITHPDDLDADVALLGRLHRGELQRYTLEKRYIRADASL
IWINLTVALVRDERDAPEFYVAVVEDLSEMRQAHFDAIHDPLTGLLNRRGFVVRARALLR
QAAEVHRAVSLIYLDLDGFKQLNDSRGHSAGDRCLVDVARLIEDMIATRHVVARMGGDEF
VLLVDEEGADLGEALRVGLMKLGGAHGGVSGSFGLVTLIPDDDTELDSIVARADEAMLAA
KRAGKNQLVTTALL